PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BS_C46781248.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 355aa    MW: 39083.7 Da    PI: 8.1511
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BS_C46781248.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.88.4e-3287143259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            dDgynWrKYGqK+vkgs++prsYY+Ct+++Cpvkkkve+++ d+++ ei+Y+g+Hnh+
  Traes_5BS_C46781248.1  87 DDGYNWRKYGQKVVKGSDCPRSYYKCTHPSCPVKKKVEHAE-DGQISEIIYKGKHNHQ 143
                            8**************************************99.***************8 PP

2WRKY108.72.8e-34243301159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+vkg+++prsYY+Ct+agC+v+k++er+++dpk+v++tYeg+Hnhe
  Traes_5BS_C46781248.1 243 LDDGYRWRKYGQKVVKGNPHPRSYYKCTFAGCNVRKHIERASSDPKAVITTYEGKHNHE 301
                            59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-2883145IPR003657WRKY domain
SuperFamilySSF1182903.01E-2585145IPR003657WRKY domain
SMARTSM007741.1E-3386144IPR003657WRKY domain
PROSITE profilePS5081123.19287145IPR003657WRKY domain
PfamPF031061.7E-2487143IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-37229303IPR003657WRKY domain
SuperFamilySSF1182901.7E-29235303IPR003657WRKY domain
PROSITE profilePS5081137.413238303IPR003657WRKY domain
SMARTSM007747.0E-40243302IPR003657WRKY domain
PfamPF031062.5E-26244301IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MSHQQALAQV TAQASHSPLR MFDHTEQTSF SAAATSSGAL QNMSSAANVA EMSEMATTIS  60
NNEHAAFQSA EASHRYQVPA PVDKPADDGY NWRKYGQKVV KGSDCPRSYY KCTHPSCPVK  120
KKVEHAEDGQ ISEIIYKGKH NHQRPPNKRA KDGSSLAAEQ NEQSNDTASG LSGVRRDQEA  180
VYGMSEQLSG LSDGDDKDDG ESRPNEADDR ESDCKRRNIQ ISSQKALTES KIIVQTTSEV  240
DLLDDGYRWR KYGQKVVKGN PHPRSYYKCT FAGCNVRKHI ERASSDPKAV ITTYEGKHNH  300
EPPVGRGSNQ NGGNSNRSQQ KGPNSMSSNQ ASHTRTDLGN VNQGQIGVLQ FKREE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-4087303877Probable WRKY transcription factor 4
2lex_A4e-4087303877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2168400.0JX216840.1 Hordeum vulgare WRKY61 protein (WRKY61) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576063.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ701e-103WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLW5FNT20.0W5FNT2_WHEAT; Uncharacterized protein
STRINGMLOC_69575.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-97WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]